Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM10755
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2672
Ki 0.3±n/a nM
Citation May JAChen HHRusinko ALynch VMSharif NAMcLaughlin MA A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem 46:4188-95 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:5-HT-2 | 5-HT-2A | 5-HT-S1A | 5-HT-S2 | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2A | Serotonin Receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52852.05
Organism:Rattus norvegicus (rat)
Description:Rat cortex membranes 5-HT2A receptors.
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: