| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50135805 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145615 (CHEMBL754334) |
|---|
| Ki | 600±n/a nM |
|---|
| Citation |  Neumeyer, JL; Zhang, A; Xiong, W; Gu, XH; Hilbert, JE; Knapp, BI; Negus, SS; Mello, NK; Bidlack, JM Design and synthesis of novel dimeric morphinan ligands for kappa and micro opioid receptors. J Med Chem46:5162-70 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50135805 |
|---|
| n/a |
|---|
| Name | BDBM50135805 |
|---|
| Synonyms: | 17-{3-[4-hydroxy-(9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-17-yl]propyl}-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-4-ol | CHEMBL424327 | MCL-133 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H46N2O2 |
|---|
| Mol. Mass. | 526.7519 |
|---|
| SMILES | Oc1ccc2C[C@@H]3[C@@H]4CCCC[C@]4(CCN3CCCN3CC[C@]45CCCC[C@H]4[C@H]3Cc3ccc(O)cc53)c2c1 |TLB:18:19:27:36.30.29| |
|---|
| Structure | 
|
|---|
Search and Browse
