Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu/kappa/delta
LigandBDBM50135800
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145395
Ki 0.03±n/a nM
Citation Neumeyer JLZhang AXiong WGu XHHilbert JEKnapp BINegus SSMello NKBidlack JM Design and synthesis of novel dimeric morphinan ligands for kappa and micro opioid receptors. J Med Chem 46:5162-70 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu/kappa/delta
Name:Opioid receptors; mu/kappa/delta
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135800
n/a
NameBDBM50135800
Synonyms:(-)-3-Hydroxy-N-cycloproypylmethylmorphinan Mandelate | 17-cyclopropylmethyl-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-4-ol | 3-Hydroxy-N-cyclopropylmethylmorphinan | CHEMBL49269 | CYCLORPHAN | US10231963, Table B.6 | US9656961, Example 00123
TypeSmall organic molecule
Emp. Form.C20H27NO
Mol. Mass.297.4345
SMILESOc1ccc2C[C@@H]3[C@@H]4CCCC[C@]4(CCN3CC3CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: