Reaction Details |
| Report a problem with these data |
Target | Interleukin-2 receptor subunit alpha |
---|
Ligand | BDBM50147993 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_89084 (CHEMBL878448) |
---|
IC50 | 150000±n/a nM |
---|
Citation | Raimundo, BC; Oslob, JD; Braisted, AC; Hyde, J; McDowell, RS; Randal, M; Waal, ND; Wilkinson, J; Yu, CH; Arkin, MR Integrating fragment assembly and biophysical methods in the chemical advancement of small-molecule antagonists of IL-2: an approach for inhibiting protein-protein interactions. J Med Chem47:3111-30 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-2 receptor subunit alpha |
---|
Name: | Interleukin-2 receptor subunit alpha |
Synonyms: | CD_antigen=CD25 | IL-2 receptor alpha subunit | IL-2-RA | IL2-RA | IL2RA_MOUSE | Il2r | Il2ra | Interleukin-2 receptor alpha chain | p55 |
Type: | PROTEIN |
Mol. Mass.: | 30733.96 |
Organism: | Mus musculus |
Description: | ChEMBL_89085 |
Residue: | 268 |
Sequence: | MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
|
|
|
BDBM50147993 |
---|
n/a |
---|
Name | BDBM50147993 |
Synonyms: | 2-Cyclohexyl-N-{2-[4-(2',4'-dichloro-biphenyl-3-yl)-piperidin-1-yl]-2-oxo-ethyl}-2-guanidino-acetamide | CHEMBL105518 |
Type | Small organic molecule |
Emp. Form. | C28H35Cl2N5O2 |
Mol. Mass. | 544.516 |
SMILES | [#7]\[#6](-[#7])=[#7]/[#6@H](-[#6]-1-[#6]-[#6]-[#6]-[#6]-[#6]-1)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-1-[#6]-[#6]-[#6](-[#6]-[#6]-1)-c1cccc(c1)-c1ccc(Cl)cc1Cl |
Structure |
|