| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 receptor subunit alpha |
|---|
| Ligand | BDBM50148007 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_89083 (CHEMBL698594) |
|---|
| IC50 | 2200000±n/a nM |
|---|
| Citation |  Raimundo, BC; Oslob, JD; Braisted, AC; Hyde, J; McDowell, RS; Randal, M; Waal, ND; Wilkinson, J; Yu, CH; Arkin, MR Integrating fragment assembly and biophysical methods in the chemical advancement of small-molecule antagonists of IL-2: an approach for inhibiting protein-protein interactions. J Med Chem47:3111-30 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 receptor subunit alpha |
|---|
| Name: | Interleukin-2 receptor subunit alpha |
|---|
| Synonyms: | CD_antigen=CD25 | IL-2 receptor alpha subunit | IL-2-RA | IL2-RA | IL2RA_MOUSE | Il2r | Il2ra | Interleukin-2 receptor alpha chain | p55 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30733.96 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_89085 |
|---|
| Residue: | 268 |
|---|
| Sequence: | MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
|
|
|
|---|
| BDBM50148007 |
|---|
| n/a |
|---|
| Name | BDBM50148007 |
|---|
| Synonyms: | (S)-2-(2-Methoxy-acetylamino)-3-(4-phenylethynyl-phenyl)-propionic acid | CHEMBL105741 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19NO4 |
|---|
| Mol. Mass. | 337.3692 |
|---|
| SMILES | COCC(=O)N[C@@H](Cc1ccc(cc1)C#Cc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
