Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGFR
LigandBDBM50150906
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302844
Ki 52±n/a nM
Citation Selliah RDHellberg MRSharif NAMcLaughlin MAWilliams GWScott DAEarnest DHaggard KSDean WDDelgado PGaines MSConrow REKlimko PG AL-12182, a novel 11-oxa prostaglandin analog with topical ocular hypotensive activity in the monkey. Bioorg Med Chem Lett 14:4525-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PTGFR
Name:Prostanoid FP receptor
Synonyms:PGF receptor | PGF2 alpha receptor | ProstaglandinF2Alpha
Type:Enzyme Catalytic Domain
Mol. Mass.:41044.75
Organism:BOVINE
Description:ProstaglandinF2Alpha PTGFR BOVINE::P37289
Residue:362
Sequence:
MSTNSSIQPVSPESELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ
KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL
CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMMLSGVCFFAVFVALLPILGHRDYKIQ
ASRTWCFYKTDEIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG
RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD
PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKDSLKVAAISDLPVTEKVTQQT
ST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150906
n/a
NameBDBM50150906
Synonyms:(E)-7-{(1R,2R,3R,5S)-3,5-Dihydroxy-2-[(E)-3-hydroxy-4-(3-trifluoromethyl-phenoxy)-but-1-enyl]-cyclopentyl}-hept-5-enoic acid isopropyl ester | CHEMBL185484
TypeSmall organic molecule
Emp. Form.C26H35F3O6
Mol. Mass.500.5477
SMILESCC(C)OC(=O)CCC\C=C\C[C@H]1[C@@H](O)C[C@@H](O)[C@@H]1\C=C\C(O)COc1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: