Reaction Details |
| Report a problem with these data |
Target | MO15-related protein kinase Pfmrk |
---|
Ligand | BDBM7458 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_306159 (CHEMBL832347) |
---|
IC50 | 7000±n/a nM |
---|
Citation | Bhattacharjee, AK; Geyer, JA; Woodard, CL; Kathcart, AK; Nichols, DA; Prigge, ST; Li, Z; Mott, BT; Waters, NC A three-dimensional in silico pharmacophore model for inhibition of Plasmodium falciparum cyclin-dependent kinases and discovery of different classes of novel Pfmrk specific inhibitors. J Med Chem47:5418-26 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
MO15-related protein kinase Pfmrk |
---|
Name: | MO15-related protein kinase Pfmrk |
Synonyms: | Protein kinase Pfmrk |
Type: | PROTEIN |
Mol. Mass.: | 37992.30 |
Organism: | Plasmodium falciparum |
Description: | ChEMBL_640752 |
Residue: | 324 |
Sequence: | MENNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKLNEISNYIDDCGINFVLL
REIKIMKEIKHKNIMSALDLYCEKDYINLVMEIMDYDLSKIINRKIFLTDSQKKCILLQI
LNGLNVLHKYYFMHRDLSPANIFINKKGEVKLADFGLCTKYGYDMYSDKLFRDKYKKNLN
LTSKVVTLWYRAPELLLGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFFL
LGTPNENNWPEALCLPLYTEFTKATKKDFKTYFKIDDDDCIDLLTSFLKLNAHERISAED
AMKHRYFFNDPLPCDISQLPFNDL
|
|
|
BDBM7458 |
---|
n/a |
---|
Name | BDBM7458 |
Synonyms: | 5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | US10278929, Apigenin | US11337935, Compound Apigenin | acs.jmedchem.1c00409_ST.789 | cid_5280443 | jm5b01461, Compound 90 |
Type | Small organic molecule |
Emp. Form. | C15H10O5 |
Mol. Mass. | 270.2369 |
SMILES | Oc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1 |
Structure |
|