Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50156138 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302776 (CHEMBL838839) |
---|
Ki | 0.6±n/a nM |
---|
Citation | Shuman, CF; Vrang, L; Danielson, UH Improved structure-activity relationship analysis of HIV-1 protease inhibitors using interaction kinetic data. J Med Chem47:5953-61 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50156138 |
---|
n/a |
---|
Name | BDBM50156138 |
Synonyms: | 2,3-Dihydroxy-1,4-bis-(2-hydroxy-indan-1-ylcarbamoyl)-4-phenoxy-butan-1-ol anion |
Type | Small organic molecule |
Emp. Form. | C30H31N2O8 |
Mol. Mass. | 547.5763 |
SMILES | O[C@H]([C@@H](O)[C@@H](Oc1ccccc1)C(=O)NC1[C@@H](O)Cc2ccccc12)[C@@H]([O-])C(=O)NC1[C@@H](O)Cc2ccccc12 |
Structure |
|