Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50159025 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303199 (CHEMBL829825) |
---|
Ki | 11.9±n/a nM |
---|
Citation | Costantino, L; Gandolfi, F; Sorbi, C; Franchini, S; Prezzavento, O; Vittorio, F; Ronsisvalle, G; Leonardi, A; Poggesi, E; Brasili, L Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem48:266-73 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50159025 |
---|
n/a |
---|
Name | BDBM50159025 |
Synonyms: | 4-Benzyl-1-(6-methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylmethyl)-piperidine | CHEMBL179530 |
Type | Small organic molecule |
Emp. Form. | C24H31NO |
Mol. Mass. | 349.509 |
SMILES | COc1ccc2CC(CN3CCC(Cc4ccccc4)CC3)CCc2c1 |
Structure |
|