| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-alpha serine/threonine-protein kinase |
|---|
| Ligand | BDBM50169959 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304601 (CHEMBL828489) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Gaillard, P; Jeanclaude-Etter, I; Ardissone, V; Arkinstall, S; Cambet, Y; Camps, M; Chabert, C; Church, D; Cirillo, R; Gretener, D; Halazy, S; Nichols, A; Szyndralewiez, C; Vitte, PA; Gotteland, JP Design and synthesis of the first generation of novel potent, selective, and in vivo active (benzothiazol-2-yl)acetonitrile inhibitors of the c-Jun N-terminal kinase. J Med Chem48:4596-607 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-alpha serine/threonine-protein kinase |
|---|
| Name: | RAC-alpha serine/threonine-protein kinase |
|---|
| Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 55681.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31749 |
|---|
| Residue: | 480 |
|---|
| Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
|---|
| BDBM50169959 |
|---|
| n/a |
|---|
| Name | BDBM50169959 |
|---|
| Synonyms: | 2-(benzo[d]thiazol-2(3H)-ylidene)-2-(2-(2-(pyridin-3-yl)ethylamino)pyrimidin-4-yl)acetonitrile | AS-601245 | AS601245 | CHEMBL1788116 | CHEMBL191384 | [3H-Benzothiazol-(2Z)-ylidene]-[2-(2-pyridin-3-yl-ethylamino)-pyrimidin-4-yl]-acetonitrile |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16N6S |
|---|
| Mol. Mass. | 372.446 |
|---|
| SMILES | N#CC(c1nc2ccccc2s1)c1ccnc(NCCc2cccnc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
