Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha-3
LigandBDBM50169959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305384
IC50 10000±n/a nM
Citation Gaillard PJeanclaude-Etter IArdissone VArkinstall SCambet YCamps MChabert CChurch DCirillo RGretener DHalazy SNichols ASzyndralewiez CVitte PAGotteland JP Design and synthesis of the first generation of novel potent, selective, and in vivo active (benzothiazol-2-yl)acetonitrile inhibitors of the c-Jun N-terminal kinase. J Med Chem 48:4596-607 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha-3
Name:Ribosomal protein S6 kinase alpha-1/alpha-3
Synonyms:90 kDa ribosomal protein S6 kinase 3 | ISPK-1 | MAP kinase-activated protein kinase 1b | MAPKAPK1B | RPS6KA3(Kin.Dom.1 - N-terminal) | Ribosomal S6 kinase 2 (RSK2) | Ribosomal protein S6 kinase | Ribosomal protein S6 kinase alpha-3 (RSK2) | S6K-alpha 3 | insulin-stimulated protein kinase 1 | p90 ribosomal s6 kinase (RSK2) | p90-RSK 3 | pp90RSK2
Type:Serine/threonine-protein kinase
Mol. Mass.:83740.03
Organism:Homo sapiens (Human)
Description:The human RSK2 sequence differed from the Genbank entry NM_004586 at one residue, V45G. The protein was cloned and purified from baculovirus expression system.
Residue:740
Sequence:
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169959
n/a
NameBDBM50169959
Synonyms:2-(benzo[d]thiazol-2(3H)-ylidene)-2-(2-(2-(pyridin-3-yl)ethylamino)pyrimidin-4-yl)acetonitrile | AS-601245 | AS601245 | CHEMBL1788116 | CHEMBL191384 | [3H-Benzothiazol-(2Z)-ylidene]-[2-(2-pyridin-3-yl-ethylamino)-pyrimidin-4-yl]-acetonitrile
TypeSmall organic molecule
Emp. Form.C20H16N6S
Mol. Mass.372.446
SMILESN#CC(c1nc2ccccc2s1)c1ccnc(NCCc2cccnc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: