Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 3 |
---|
Ligand | BDBM50169959 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_304610 (CHEMBL828497) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Gaillard, P; Jeanclaude-Etter, I; Ardissone, V; Arkinstall, S; Cambet, Y; Camps, M; Chabert, C; Church, D; Cirillo, R; Gretener, D; Halazy, S; Nichols, A; Szyndralewiez, C; Vitte, PA; Gotteland, JP Design and synthesis of the first generation of novel potent, selective, and in vivo active (benzothiazol-2-yl)acetonitrile inhibitors of the c-Jun N-terminal kinase. J Med Chem48:4596-607 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitogen-activated protein kinase 3 |
---|
Name: | Mitogen-activated protein kinase 3 |
Synonyms: | ERK1 | ERK1/ERK2 | Extracellular signal-regulated kinase 1 | Extracellular signal-regulated kinase 1 (ERK1) | MAP kinase ERK1 | MAPK3 | MAPK3/MAPK7 | MK03_HUMAN | Mitogen-activated protein kinase | Mitogen-activated protein kinase 3 | PRKM3 |
Type: | Protein |
Mol. Mass.: | 43136.58 |
Organism: | Homo sapiens (Human) |
Description: | curated by PDB 4QTB |
Residue: | 379 |
Sequence: | MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
|
|
|
BDBM50169959 |
---|
n/a |
---|
Name | BDBM50169959 |
Synonyms: | 2-(benzo[d]thiazol-2(3H)-ylidene)-2-(2-(2-(pyridin-3-yl)ethylamino)pyrimidin-4-yl)acetonitrile | AS-601245 | AS601245 | CHEMBL1788116 | CHEMBL191384 | [3H-Benzothiazol-(2Z)-ylidene]-[2-(2-pyridin-3-yl-ethylamino)-pyrimidin-4-yl]-acetonitrile |
Type | Small organic molecule |
Emp. Form. | C20H16N6S |
Mol. Mass. | 372.446 |
SMILES | N#CC(c1nc2ccccc2s1)c1ccnc(NCCc2cccnc2)n1 |
Structure |
|