Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50171511 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305870 (CHEMBL831914) |
---|
pH | 7.4±n/a |
---|
IC50 | >110000±n/a nM |
---|
Comments | extracted |
---|
Citation | Gangjee, A; Zeng, Y; McGuire, JJ; Kisliuk, RL Synthesis of classical, four-carbon bridged 5-substituted furo[2,3-d]pyrimidine and 6-substituted pyrrolo[2,3-d]pyrimidine analogues as antifolates. J Med Chem48:5329-36 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50171511 |
---|
n/a |
---|
Name | BDBM50171511 |
Synonyms: | (S)-2-(4-(4-(2-amino-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidin-6-yl)butyl)benzamido)pentanedioic acid | (S)-2-{4-[4-(2-Amino-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidin-6-yl)-butyl]-benzoylamino}-pentanedioic acid | CHEMBL365307 | N-{4-[4-(2-Amino-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]benzoyl}-L-glutamic Acid |
Type | Small organic molecule |
Emp. Form. | C22H25N5O6 |
Mol. Mass. | 455.4638 |
SMILES | Nc1nc2[nH]c(CCCCc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cc2c(=O)[nH]1 |r| |
Structure |
|