Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50165019
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320917
Ki 5.3±n/a nM
Citation Naito RYonetoku YOkamoto YToyoshima AIkeda KTakeuchi M Synthesis and antimuscarinic properties of quinuclidin-3-yl 1,2,3,4-tetrahydroisoquinoline-2-carboxylate derivatives as novel muscarinic receptor antagonists. J Med Chem 48:6597-606 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic receptor M2 and M3
Synonyms:Cholinergic, muscarinic M3
Type:Enzyme Catalytic Domain
Mol. Mass.:66086.66
Organism:RAT
Description:Cholinergic, muscarinic M3 CHRM3 RAT::P08483
Residue:589
Sequence:
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK
RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ
KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165019
n/a
NameBDBM50165019
Synonyms:4-(Diethylamino)-2-butynyl alpha-phenylcyclohexaneglycolic acid ester | 4-(diethylamino)but-2-yn-1-yl cyclohexyl(hydroxy)phenylacetate | 4-Diethylamino-2-butinyl alpha-cyclohexylmandelat | 4-Diethylamino-2-butynyl alpha-phenylcyclohexaneglycolate | Benzeneacetic acid, alpha-cyclohexyl-alpha-hydroxy-, 4-(diethylamino)-2-butynyl ester | CHEMBL1231 | Cyclohexaneglycolic acid, alpha-phenyl-, 4-(diethylamino)-2-butynyl ester | OXYBUTYNIN CHLORIDE
TypeSmall organic molecule
Emp. Form.C22H31NO3
Mol. Mass.357.4864
SMILESCCN(CC)CC#CCOC(=O)C(O)(C1CCCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: