Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50179280 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_325592 (CHEMBL860270) |
---|
EC50 | 25500±n/a nM |
---|
Citation | Berardi, F; Ferorelli, S; Abate, C; Pedone, MP; Colabufo, NA; Contino, M; Perrone, R Methyl substitution on the piperidine ring of N-[omega-(6-methoxynaphthalen-1-yl)alkyl] derivatives as a probe for selective binding and activity at the sigma(1) receptor. J Med Chem48:8237-44 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50179280 |
---|
n/a |
---|
Name | BDBM50179280 |
Synonyms: | 1-(4-(6-methoxynaphthalen-1-yl)butyl)-4-methylpiperidine | CHEMBL176941 | CHEMBL545278 |
Type | Small organic molecule |
Emp. Form. | C21H29NO |
Mol. Mass. | 311.4611 |
SMILES | COc1ccc2c(CCCCN3CCC(C)CC3)cccc2c1 |
Structure |
|