Reaction Details |
| Report a problem with these data |
Target | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
---|
Ligand | BDBM50180100 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_330090 (CHEMBL863388) |
---|
IC50 | >1000000±n/a nM |
---|
Citation | Kim, P; Zhang, YM; Shenoy, G; Nguyen, QA; Boshoff, HI; Manjunatha, UH; Goodwin, MB; Lonsdale, J; Price, AC; Miller, DJ; Duncan, K; White, SW; Rock, CO; Barry, CE; Dowd, CS Structure-activity relationships at the 5-position of thiolactomycin: an intact (5R)-isoprene unit is required for activity against the condensing enzymes from Mycobacterium tuberculosis and Escherichia coli. J Med Chem49:159-71 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxoacyl-[acyl-carrier-protein] synthase 3 |
---|
Name: | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
Synonyms: | 3-oxoacyl-[acyl-carrier-protein] synthase | 3-oxoacyl-[acyl-carrier-protein] synthase 3 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Beta-ketoacyl-ACP synthase III (FabH) |
Type: | Enzyme |
Mol. Mass.: | 33506.68 |
Organism: | Escherichia coli |
Description: | C3TDZ2 |
Residue: | 317 |
Sequence: | MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH
ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL
LEAFGGGFTWGSALVRF
|
|
|
BDBM50180100 |
---|
n/a |
---|
Name | BDBM50180100 |
Synonyms: | 3,5-dimethyl-4-hydroxy-5-phenethyl-5H-thiophen-2-one | CHEMBL199900 |
Type | Small organic molecule |
Emp. Form. | C14H16O2S |
Mol. Mass. | 248.341 |
SMILES | CC1C(=O)SC(C)(CCc2ccccc2)C1=O |
Structure |
|