| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50183625 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_340965 (CHEMBL866517) |
|---|
| Ki | 3.5±n/a nM |
|---|
| Citation |  Ekegren, JK; Ginman, N; Johansson, A; Wallberg, H; Larhed, M; Samuelsson, B; Unge, T; Hallberg, A Microwave-accelerated synthesis of P1'-extended HIV-1 protease inhibitors encompassing a tertiary alcohol in the transition-state mimicking scaffold. J Med Chem49:1828-32 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50183625 |
|---|
| n/a |
|---|
| Name | BDBM50183625 |
|---|
| Synonyms: | CHEMBL381588 | {(1S)-1-[N'-[(2S)-2-hydroxy-2-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-3-phenyl-propyl]-N'-[4-(benzo[b]thiophene-2-yl)-benzyl]-hydrazinocarbonyl]-2,2-dimethyl-propyl}-carbamic acid methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H46N4O6S |
|---|
| Mol. Mass. | 734.903 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)NN(Cc1ccc(cc1)-c1cc2ccccc2s1)C[C@@](O)(Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
