| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM4703 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_347177 (CHEMBL862664) |
|---|
| Ki | 1083±n/a nM |
|---|
| Citation |  Nishimori, I; Vullo, D; Minakuchi, T; Morimoto, K; Onishi, S; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors: cloning and sulfonamide inhibition studies of a carboxyterminal truncated alpha-carbonic anhydrase from Helicobacter pylori. Bioorg Med Chem Lett16:2182-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | Beta-carbonic anhydrase | CYNT_HELPY | Carbonic anhydrase 1 | cynT | hpβCA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25517.77 |
|---|
| Organism: | Helicobacter pylori (strain G27) |
|---|
| Description: | O24855 |
|---|
| Residue: | 221 |
|---|
| Sequence: | MKAFLGALEFQENEYEELKELYESLKTKQKPHTLFISCVDSRVVPNLITGTKPGELYVIC
NMGNVNPPKTSYKESLSTIASIEYAIAHVGVQNLIICGHSDCGACGSVHLIHDETTKAKT
PYIANWIQFLEPVKEELKNHPQFSNHFAKRSWLTERLNARLQLNNLLSYDFIQEKASKNE
LKIFGWHYIIETGRIYNYNFESHFFEPIGETIKQRKSHENF
|
|
|
|---|
| BDBM4703 |
|---|
| n/a |
|---|
| Name | BDBM4703 |
|---|
| Synonyms: | 4-carboxybenzenesulfonamide 1 | 4-sulfamoylbenzoic acid | Benzoic Acid deriv. 31 | CHEMBL414 | JMC522226 Compound 22 | JMC523116 Compound 22 | JMC52646 Compound 23 | aromatic/heteroaromatic sulfonamide 23 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H7NO4S |
|---|
| Mol. Mass. | 201.2 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
