Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50185958 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_352426 (CHEMBL859957) |
---|
Ki | 0.07±n/a nM |
---|
Citation | Zhang, MR; Ogawa, M; Maeda, J; Ito, T; Noguchi, J; Kumata, K; Okauchi, T; Suhara, T; Suzuki, K [2-11C]isopropyl-, [1-11C]ethyl-, and [11C]methyl-labeled phenoxyphenyl acetamide derivatives as positron emission tomography ligands for the peripheral benzodiazepine receptor: radiosynthesis, uptake, and in vivo binding in brain. J Med Chem49:2735-42 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50185958 |
---|
n/a |
---|
Name | BDBM50185958 |
Synonyms: | CHEMBL205971 | N-(2-methoxybenzyl)-N-(4-chloro-2-phenoxyphenyl)acetamide |
Type | Small organic molecule |
Emp. Form. | C22H20ClNO3 |
Mol. Mass. | 381.852 |
SMILES | COc1ccccc1CN(C(C)=O)c1ccc(Cl)cc1Oc1ccccc1 |
Structure |
|