Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50185157 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_359170 (CHEMBL869329) |
---|
IC50 | 2430±n/a nM |
---|
Citation | Marastoni, M; Baldisserotto, A; Trapella, C; Gavioli, R; Tomatis, R P3 and P4 position analysis of vinyl ester pseudopeptide proteasome inhibitors. Bioorg Med Chem Lett16:3125-30 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50185157 |
---|
n/a |
---|
Name | BDBM50185157 |
Synonyms: | CHEMBL210901 | benzyl (S)-4-methyl-1-((S)-4-methyl-1-((S,E)-5-methyl-1-(methylsulfonyl)hex-1-en-3-ylamino)-1-oxopentan-2-ylamino)-1-oxopentan-2-ylcarbamate |
Type | Small organic molecule |
Emp. Form. | C28H45N3O6S |
Mol. Mass. | 551.738 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)C=CS(C)(=O)=O |w:33.34| |
Structure |
|