| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50185159 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_359170 (CHEMBL869329) |
|---|
| IC50 | 32±n/a nM |
|---|
| Citation |  Marastoni, M; Baldisserotto, A; Trapella, C; Gavioli, R; Tomatis, R P3 and P4 position analysis of vinyl ester pseudopeptide proteasome inhibitors. Bioorg Med Chem Lett16:3125-30 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50185159 |
|---|
| n/a |
|---|
| Name | BDBM50185159 |
|---|
| Synonyms: | CHEMBL208162 | Hmb-Phe-Gln-Leu-VE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H42N4O7 |
|---|
| Mol. Mass. | 594.6985 |
|---|
| SMILES | CCOC(=O)\C=C\[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)c1cccc(O)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
