Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHeme oxygenase 1
LigandBDBM50183063
Substrate/Competitorn/a
Meas. Tech.ChEMBL_368941
IC50 1500±n/a nM
Citation Vlahakis JZKinobe RTBowers RJBrien JFNakatsu KSzarek WA Imidazole-dioxolane compounds as isozyme-selective heme oxygenase inhibitors. J Med Chem 49:4437-41 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Heme oxygenase 1
Name:Heme oxygenase 1
Synonyms:HO-1
Type:PROTEIN
Mol. Mass.:32822.24
Organism:Homo sapiens (Human)
Description:ChEMBL_368941
Residue:288
Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183063
n/a
NameBDBM50183063
Synonyms:(2R,4R)-2-[2-(4-chlorophenyl)ethyl]-2-[(1H-imidazol-1-yl)-methyl]-4-methyl-1,3-dioxolane hydrochloride | 1-(((2R,4R)-2-(4-chlorophenethyl)-4-methyl-1,3-dioxolan-2-yl)methyl)-1H-imidazole hydrochloride | CHEMBL536056
TypeSmall organic molecule
Emp. Form.C16H19ClN2O2
Mol. Mass.306.787
SMILESC[C@@H]1CO[C@@](CCc2ccc(Cl)cc2)(Cn2ccnc2)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: