| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50193543 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_386434 (CHEMBL854561) |
|---|
| Ki | 0.600000±n/a nM |
|---|
| Citation |  Nieland, NP; Moynihan, HA; Carrington, S; Broadbear, J; Woods, JH; Traynor, JR; Husbands, SM; Lewis, JW Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorphinones and codeinones. J Med Chem49:5333-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50193543 |
|---|
| n/a |
|---|
| Name | BDBM50193543 |
|---|
| Synonyms: | N-cyclopropylmethyl-14beta-(2'-chlorocinnamoylamino)-7,8-dihydronorcodeinone |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H31ClN2O4 |
|---|
| Mol. Mass. | 519.031 |
|---|
| SMILES | COc1ccc2CC3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35NC(=O)\C=C\c1ccccc1Cl |TLB:4:5:24:8.14.13,18:19:24:8.14.13| |
|---|
| Structure | 
|
|---|
Search and Browse
