Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50195527
Substrate/Competitorn/a
Meas. Tech.ChEMBL_414849
Ki 1±n/a nM
Citation Manera CBenetti VCastelli MPCavallini TLazzarotti SPibiri FSaccomanni GTuccinardi TVannacci AMartinelli AFerrarini PL Design, synthesis, and biological evaluation of new 1,8-naphthyridin-4(1H)-on-3-carboxamide and quinolin-4(1H)-on-3-carboxamide derivatives as CB2 selective agonists. J Med Chem 49:5947-57 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50195527
n/a
NameBDBM50195527
Synonyms:CHEMBL387001 | N-cycloheptyl-1-(p-fluorobenzyl)-7-methyl-1,8-naphthyridin-4(1H)-on-3-carboxamide
TypeSmall organic molecule
Emp. Form.C24H26FN3O2
Mol. Mass.407.4805
SMILESCc1ccc2c(n1)n(Cc1ccc(F)cc1)cc(C(=O)NC1CCCCCC1)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: