| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50195677 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_416468 (CHEMBL907181) |
|---|
| Ki | 0.700000±n/a nM |
|---|
| Citation |  Rennison, D; Moynihan, H; Traynor, JR; Lewis, JW; Husbands, SM Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effects of changes to the chain linking of the C14-amino group to the aryl ring. J Med Chem49:6104-10 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50195677 |
|---|
| n/a |
|---|
| Name | BDBM50195677 |
|---|
| Synonyms: | (1R,5R,13R,17S)-17-{[(2E)-3-(4-chlorophenyl)prop-2-en-1-yl]amino}-4-(cyclopropylmethyl)-10-methoxy-12-oxa-4-azapentacyclo[9.6.1.0^{1,13}.0^{5,17}.0^{7,18}]octadeca-7(18),8,10-trien-14-one | CHEMBL216251 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H33ClN2O3 |
|---|
| Mol. Mass. | 505.048 |
|---|
| SMILES | COc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35NC\C=C\c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
