Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50195673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_416468 (CHEMBL907181) |
---|
Ki | 0.040000±n/a nM |
---|
Citation | Rennison, D; Moynihan, H; Traynor, JR; Lewis, JW; Husbands, SM Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effects of changes to the chain linking of the C14-amino group to the aryl ring. J Med Chem49:6104-10 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50195673 |
---|
n/a |
---|
Name | BDBM50195673 |
Synonyms: | CHEMBL267027 | N-cyclopropylmethyl-14beta-[3'-(4'-chlorophenyl)propanamido]-7,8-dihydronormorphinone |
Type | Small organic molecule |
Emp. Form. | C29H31ClN2O4 |
Mol. Mass. | 507.02 |
SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35NC(=O)CCc1ccc(Cl)cc1 |
Structure |
|