Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50199896 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_422439 (CHEMBL908255) |
---|
Ki | 31±n/a nM |
---|
Citation | Le Bourdonnec, B; Goodman, AJ; Michaut, M; Ye, HF; Graczyk, TM; Belanger, S; Herbertz, T; Yap, GP; DeHaven, RN; Dolle, RE Elucidation of the bioactive conformation of the N-substituted trans-3,4-dimethyl-4-(3-hydroxyphenyl)piperidine class of mu-opioid receptor antagonists. J Med Chem49:7278-89 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50199896 |
---|
n/a |
---|
Name | BDBM50199896 |
Synonyms: | 3-((2R,3R,7S,9-alpha-S)-2,3-dimethyl-7-phenyl-octahydro-1H-quinolizin-2-yl)phenol | 3-((2R,3R,7S,9aS)-2,3-dimethyl-7-phenyl-octahydro-1H-quinolizin-2-yl)phenol | CHEMBL426523 | US8580788, 56 |
Type | Small organic molecule |
Emp. Form. | C23H29NO |
Mol. Mass. | 335.4825 |
SMILES | C[C@H]1CN2C[C@@H](CC[C@H]2C[C@@]1(C)c1cccc(O)c1)c1ccccc1 |r| |
Structure |
|