| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase, mitochondrial |
|---|
| Ligand | BDBM50201870 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_423227 (CHEMBL912248) |
|---|
| IC50 | 360000±n/a nM |
|---|
| Citation |  Boularot, A; Giglione, C; Petit, S; Duroc, Y; Alves de Sousa, R; Larue, V; Cresteil, T; Dardel, F; Artaud, I; Meinnel, T Discovery and refinement of a new structural class of potent peptide deformylase inhibitors. J Med Chem50:10-20 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase, mitochondrial |
|---|
| Name: | Peptide deformylase, mitochondrial |
|---|
| Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27023.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_154318 |
|---|
| Residue: | 243 |
|---|
| Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
|---|
| BDBM50201870 |
|---|
| n/a |
|---|
| Name | BDBM50201870 |
|---|
| Synonyms: | 2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide | CHEMBL216480 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H11BrN2O2 |
|---|
| Mol. Mass. | 283.121 |
|---|
| SMILES | ONCC(=O)Cc1c[nH]c2ccc(Br)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
