Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide deformylase 1A, chloroplastic
LigandBDBM50089194
Substrate/Competitorn/a
Meas. Tech.ChEMBL_423228
IC50 27±n/a nM
Citation Boularot AGiglione CPetit SDuroc YAlves de Sousa RLarue VCresteil TDardel FArtaud IMeinnel T Discovery and refinement of a new structural class of potent peptide deformylase inhibitors. J Med Chem 50:10-20 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptide deformylase 1A, chloroplastic
Name:Peptide deformylase 1A, chloroplastic
Synonyms:AtDEF1 | AtDEF1A | PDF 1A | Polypeptide deformylase
Type:PROTEIN
Mol. Mass.:30001.50
Organism:Arabidopsis thaliana
Description:ChEMBL_423228
Residue:269
Sequence:
MGLHRDEATAMETLFRVSLRLLPVSAAVTCRSIRFPVSRPGSSHLLNRKLYNLPTSSSSS
LSTKAGWLLGLGEKKKKVDLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMR
LAPGVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEILAQERRHFDLMVMVNPVLKERSNK
KALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDGNLY
VDKMVPRTFRTVDNLDLPLAEGCPKLGPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089194
n/a
NameBDBM50089194
Synonyms:(R)-N*4*-Hydroxy-N*1*-[(S)-1-((S)-2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-pentyl-succinamide | (R)-N4-hydroxy-N1-((S)-1-((S)-2-(hydroxymethyl)pyrrolidin-1-yl)-3-methyl-1-oxobutan-2-yl)-2-pentylsuccinamide | ACTINONIN | CHEMBL308333 | N*4*-Hydroxy-N*1*-[(S)-1-((S)-2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-(R)-pentyl-succinamide | N*4*-Hydroxy-N*1*-[1-(2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-pentyl-succinamide
TypeSmall organic molecule
Emp. Form.C19H35N3O5
Mol. Mass.385.4983
SMILESCCCCC[C@H](CC(=O)NO)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: