| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50205315 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_425937 (CHEMBL906334) |
|---|
| IC50 | 60.1±n/a nM |
|---|
| Citation |  Zhang, MR; Kumata, K; Maeda, J; Haradahira, T; Noguchi, J; Suhara, T; Halldin, C; Suzuki, K N-(5-Fluoro-2-phenoxyphenyl)-N-(2-[(131)I]iodo-5-me thoxybenzyl)acetamide: a potent iodinated radioligand for the peripheral-type benzodiazepine receptor in brain. J Med Chem50:848-55 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50205315 |
|---|
| n/a |
|---|
| Name | BDBM50205315 |
|---|
| Synonyms: | CHEMBL220642 | N-(2,5-dimethoxybenzyl)-N-(5-iodo-2-phenoxyphenyl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22INO4 |
|---|
| Mol. Mass. | 503.3296 |
|---|
| SMILES | COc1ccc(OC)c(CN(C(C)=O)c2cc(I)ccc2Oc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
