Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty-acid amide hydrolase 1
LigandBDBM50204478
Substrate/Competitorn/a
Meas. Tech.ChEMBL_428054
Ki 0.6±n/a nM
Citation Romero FADu WHwang IRayl TJKimball FSLeung DHoover HSApodaca RLBreitenbucher JGCravatt BFBoger DL Potent and selective alpha-ketoheterocycle-based inhibitors of the anandamide and oleamide catabolizing enzyme, fatty acid amide hydrolase. J Med Chem 50:1058-68 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty-acid amide hydrolase 1
Name:Fatty-acid amide hydrolase 1
Synonyms:Anandamide amidohydrolase | Anandamide amidohydrolase 1 | FAAH | FAAH1 | Fatty Acid Amide Hydrolase (FAAH) | Fatty-acid amide hydrolase (FAAH) | Oleamide hydrolase 1
Type:Protein
Mol. Mass.:63071.19
Organism:Homo sapiens (Human)
Description:O00519
Residue:579
Sequence:
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204478
n/a
NameBDBM50204478
Synonyms:1-(5-(4-methylpyridin-2-yl)oxazol-2-yl)-7-phenylheptan-1-one | CHEMBL219658
TypeSmall organic molecule
Emp. Form.C22H24N2O2
Mol. Mass.348.4382
SMILESCc1ccnc(c1)-c1cnc(o1)C(=O)CCCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: