| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 5A, mitochondrial |
|---|
| Ligand | BDBM50027536 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_442426 (CHEMBL892591) |
|---|
| Ki | 41700000±n/a nM |
|---|
| Citation |  Temperini, C; Innocenti, A; Guerri, A; Scozzafava, A; Rusconi, S; Supuran, CT Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I. Bioorg Med Chem Lett17:2210-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 5A, mitochondrial |
|---|
| Name: | Carbonic anhydrase 5A, mitochondrial |
|---|
| Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34755.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human (cloned) isozyme |
|---|
| Residue: | 305 |
|---|
| Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
|---|
| BDBM50027536 |
|---|
| n/a |
|---|
| Name | BDBM50027536 |
|---|
| Synonyms: | (phosphonoformate)Trisodium phosphonoformate | Antiviral agent : Inhibitor of reverse transcriptase of Human T-cell lymphotropic, virus type III, useful in the treatment of HSV-1 infections | CHEMBL754 | EHB-776 | FOSCARNET SODIUM | Foscarnet | Foscavir | phosphonoformate trisodium salt | trisodium dioxidophosphinecarboxylate oxide | trisodium dioxidophosphinecarboxylate oxide with 6 molecules of water(foscarnet) | trisodium phosphonoformate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | CO5P |
|---|
| Mol. Mass. | 122.9831 |
|---|
| SMILES | [O-]C(=O)P([O-])([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
