Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM50213694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_459067
IC50 270000±n/a nM
Citation Jain KSKathiravan MKSomani RSShishoo CJ The biology and chemistry of hyperlipidemia. Bioorg Med Chem 15:4674-99 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic lipase
Synonyms:PL
Type:PROTEIN
Mol. Mass.:51157.75
Organism:Homo sapiens (Human)
Description:ChEMBL_527250
Residue:465
Sequence:
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213694
n/a
NameBDBM50213694
Synonyms:(R)-2-((2E,8E)-deca-2,8-dienoylamino)-3-((R)-5-hydroxy-6-oxo-3,8-dioxa-tricyclo[5.1.0.0*2,4*]oct-5-yl)-propionic acid methyl ester | CHEMBL253780
TypeSmall organic molecule
Emp. Form.C20H27NO7
Mol. Mass.393.4309
SMILESCOC(=O)[C@@H](C[C@@]1(O)C2OC2C2OC2C1=O)NC(=O)\C=C\CCCC\C=C\C |w:10.9,8.8,13.13,11.12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: