| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50227855 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_461588 (CHEMBL927611) |
|---|
| IC50 | 1±n/a nM |
|---|
| Citation |  Duan, JJ; Chen, L; Lu, Z; Xue, CB; Liu, RQ; Covington, MB; Qian, M; Wasserman, ZR; Vaddi, K; Christ, DD; Trzaskos, JM; Newton, RC; Decicco, CP Discovery of beta-benzamido hydroxamic acids as potent, selective, and orally bioavailable TACE inhibitors. Bioorg Med Chem Lett18:241-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50227855 |
|---|
| n/a |
|---|
| Name | BDBM50227855 |
|---|
| Synonyms: | CHEMBL254307 | N-(2-(hydroxycarbamoyl)cyclobutyl)-4-((2-methylquinolin-4-yl)methoxy)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N3O4 |
|---|
| Mol. Mass. | 405.4464 |
|---|
| SMILES | Cc1cc(COc2ccc(cc2)C(=O)NC2CCC2C(=O)NO)c2ccccc2n1 |w:15.15,18.20| |
|---|
| Structure | 
|
|---|
Search and Browse
