Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM50371568
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463775
Ki 140±n/a nM
Citation Ettari RNizi EDi Francesco MEDude MAPradel GVicík RSchirmeister TMicale NGrasso SZappalà M Development of peptidomimetics with a vinyl sulfone warhead as irreversible falcipain-2 inhibitors. J Med Chem 51:988-96 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Falcipain-2
Name:Falcipain 2
Synonyms:Cysteine protease falcipain-2 | Falcipain 2
Type:Enzyme
Mol. Mass.:55912.60
Organism:Plasmodium falciparum
Description:Recombinant falcipain-2.
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371568
n/a
NameBDBM50371568
Synonyms:CHEMBL408071
TypeSmall organic molecule
Emp. Form.C35H28ClF3N4O6S
Mol. Mass.725.133
SMILESFC(F)(F)c1cc(Cl)ccc1NC(=O)OC[C@H]1N=C(c2ccccc2)c2ccccc2N(CC(=O)NCC=CS(=O)(=O)c2ccccc2)C1=O |w:37.39,t:18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: