Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50371784 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_464067 (CHEMBL949060) |
---|
IC50 | 1±n/a nM |
---|
Citation | Walters, I; Austin, C; Austin, R; Bonnert, R; Cage, P; Christie, M; Ebden, M; Gardiner, S; Grahames, C; Hill, S; Hunt, F; Jewell, R; Lewis, S; Martin, I; David Nicholls, na; David Robinson, na Evaluation of a series of bicyclic CXCR2 antagonists. Bioorg Med Chem Lett18:798-803 (2008) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50371784 |
---|
n/a |
---|
Name | BDBM50371784 |
Synonyms: | CHEMBL446458 |
Type | Small organic molecule |
Emp. Form. | C15H14F2N4O2S2 |
Mol. Mass. | 384.424 |
SMILES | C[C@H](CO)Nc1[nH]c(SCc2cccc(F)c2F)nc2nc(=O)sc12 |
Structure |
|