Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetchemokine (C-X-C motif) receptor 3
LigandBDBM50372013
Substrate/Competitorn/a
Meas. Tech.ChEMBL_464453
Ki 26±n/a nM
Citation Knight RLAllen DRBirch HLChapman GAGalvin FCJopling LALock CJMeissner JWOwen DARaphy GWatson RJWilliams SC Development of CXCR3 antagonists. Part 4: discovery of 2-amino-(4-tropinyl)quinolines. Bioorg Med Chem Lett 18:629-33 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
chemokine (C-X-C motif) receptor 3
Name:chemokine (C-X-C motif) receptor 3
Synonyms:AAO92295.1 | C-X-C chemokine receptor type 3 | C-X-C chemokine receptor type 3 (CXCR3) | C-X-C chemokine receptor type 3 (CXCR3A) | CXCR3A
Type:Enzyme Catalytic Domain
Mol. Mass.:40665.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:368
Sequence:
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50372013
n/a
NameBDBM50372013
Synonyms:CHEMBL256190
TypeSmall organic molecule
Emp. Form.C25H31ClN4O
Mol. Mass.438.993
SMILESCC(=O)N1C2CCCC1C=C(CN1CCC(CC1)Nc1ccc3cc(Cl)ccc3n1)C2 |w:4.34,8.9,t:10,TLB:1:3:10.30.9:7.5.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: