| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl2-associated agonist of cell death |
|---|
| Ligand | BDBM50372180 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_464767 (CHEMBL930133) |
|---|
| Ki | 2300±n/a nM |
|---|
| Citation |  Wang, L; Kong, F; Kokoski, CL; Andrews, DW; Xing, C Development of dimeric modulators for anti-apoptotic Bcl-2 proteins. Bioorg Med Chem Lett18:236-40 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl2-associated agonist of cell death |
|---|
| Name: | Bcl2-associated agonist of cell death |
|---|
| Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18393.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_478760 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
|---|
| BDBM50372180 |
|---|
| n/a |
|---|
| Name | BDBM50372180 |
|---|
| Synonyms: | CHEMBL270646 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H36N2O9S4 |
|---|
| Mol. Mass. | 841.003 |
|---|
| SMILES | OC(=O)[C@H](Cc1ccccc1)N1C(=S)S\C(=C/c2ccc(OCCOCCOc3ccc(\C=C4/SC(=S)N([C@@H](Cc5ccccc5)C(O)=O)C4=O)cc3)cc2)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
