| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM16314 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_466863 (CHEMBL921563) |
|---|
| IC50 | 1000±n/a nM |
|---|
| Citation |  Gallego, O; Ruiz, FX; Ardèvol, A; Domínguez, M; Alvarez, R; de Lera, AR; Rovira, C; Farrés, J; Fita, I; Parés, X Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10. Proc Natl Acad Sci U S A104:20764-9 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35797.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1512484 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
|---|
| BDBM16314 |
|---|
| n/a |
|---|
| Name | BDBM16314 |
|---|
| Synonyms: | 2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14F3NO3S |
|---|
| Mol. Mass. | 357.347 |
|---|
| SMILES | COc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
