| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50048866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_469590 (CHEMBL934063) |
|---|
| Ki | 1.48±n/a nM |
|---|
| Citation |  Mésangeau, C; Narayanan, S; Green, AM; Shaikh, J; Kaushal, N; Viard, E; Xu, YT; Fishback, JA; Poupaert, JH; Matsumoto, RR; McCurdy, CR Conversion of a highly selective sigma-1 receptor-ligand to sigma-2 receptor preferring ligands with anticocaine activity. J Med Chem51:1482-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50048866 |
|---|
| n/a |
|---|
| Name | BDBM50048866 |
|---|
| Synonyms: | 1-Cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-piperazine | 1-cyclohexyl-4-(3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl)piperazine | 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)propyl]piperazine | 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl]piperazine | CHEMBL53325 | PB-28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H38N2O |
|---|
| Mol. Mass. | 370.5713 |
|---|
| SMILES | COc1cccc2C(CCCN3CCN(CC3)C3CCCCC3)CCCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
