Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 9
LigandBDBM15908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_473723
Ki 4±n/a nM
Citation Fedorov OMarsden BPogacic VRellos PMüller SBullock ANSchwaller JSundström MKnapp S A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci USA 104:20523-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 9
Name:JNK2/JNK3
Synonyms:JNK-55 | JNK2/JNK3 | Mitogen-Activated Protein Kinase 9 (JNK2) | Stress-activated protein kinase JNK2 | c-Jun N-terminal kinase 2 | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48131.49
Organism:Homo sapiens (Human)
Description:JNK-2 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:424
Sequence:
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15908
n/a
NameBDBM15908
Synonyms:Aminopyridine-Based Inhibitor 6o | N-(4-Amino-5-cyano-6-ethoxypyridin-2-yl)-2-(2,5-dimethoxyphenyl)acetamide | aminopyridine deriv. 2
TypeSmall organic molecule
Emp. Form.C18H20N4O4
Mol. Mass.356.3758
SMILESCCOc1nc(NC(=O)Cc2cc(OC)ccc2OC)cc(N)c1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: