Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 5B, mitochondrial |
---|
Ligand | BDBM10881 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_475789 (CHEMBL935614) |
---|
Ki | 62±n/a nM |
---|
Citation | Di Fiore, A; Pedone, C; Antel, J; Waldeck, H; Witte, A; Wurl, M; Scozzafava, A; Supuran, CT; De Simone, G Carbonic anhydrase inhibitors: the X-ray crystal structure of ethoxzolamide complexed to human isoform II reveals the importance of thr200 and gln92 for obtaining tight-binding inhibitors. Bioorg Med Chem Lett18:2669-74 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 5B, mitochondrial |
---|
Name: | Carbonic anhydrase 5B, mitochondrial |
Synonyms: | CA-VB | CA5B | CAH5B_HUMAN | Carbonate dehydratase VB | Carbonic Anhydrase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VB (CA VB) |
Type: | Enzyme |
Mol. Mass.: | 36440.83 |
Organism: | Homo sapiens (Human) |
Description: | Human (cloned) isozyme |
Residue: | 317 |
Sequence: | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
|
|
|
BDBM10881 |
---|
n/a |
---|
Name | BDBM10881 |
Synonyms: | CHEMBL288100 | MZA3 | Methazolamide | Methazolamide (MZA) | Methazolamide, MZA | N-[(2Z)-3-methyl-5-sulfamoyl-2,3-dihydro-1,3,4-thiadiazol-2-ylidene]acetamide | Sulfonamide, 2 | cid_4100 | sulfonamide 2 |
Type | Small organic molecule |
Emp. Form. | C5H8N4O3S2 |
Mol. Mass. | 236.272 |
SMILES | CC(=O)N=c1sc(nn1C)S(N)(=O)=O |w:3.2| |
Structure |
|