Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 13 |
---|
Ligand | BDBM10885 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_475794 (CHEMBL935619) |
---|
Ki | 10±n/a nM |
---|
Citation | Di Fiore, A; Pedone, C; Antel, J; Waldeck, H; Witte, A; Wurl, M; Scozzafava, A; Supuran, CT; De Simone, G Carbonic anhydrase inhibitors: the X-ray crystal structure of ethoxzolamide complexed to human isoform II reveals the importance of thr200 and gln92 for obtaining tight-binding inhibitors. Bioorg Med Chem Lett18:2669-74 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 13 |
---|
Name: | Carbonic anhydrase 13 |
Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
Type: | Enzyme |
Mol. Mass.: | 29522.80 |
Organism: | Mus musculus (mouse) |
Description: | Murine cloned isozyme |
Residue: | 262 |
Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
BDBM10885 |
---|
n/a |
---|
Name | BDBM10885 |
Synonyms: | (4R)-4-(ethylamino)-2-(3-methoxypropyl)-1,1-dioxo-2H,3H,4H-1,7,2-thieno[3,2-e][1,2]thiazine-6-sulfonamide | (R)-4-(ethylamino)-3,4-dihydro-2-(3-methoxypropyl)-2H-thieno(3,2-E)-1,2-thiazine-6-sulfonamide 1,1-dioxide | AL-4862 | Azopt | Brinzolamide (BRZ) | brinzolamide |
Type | Small organic molecule |
Emp. Form. | C12H21N3O5S3 |
Mol. Mass. | 383.507 |
SMILES | CCN[C@H]1CN(CCCOC)S(=O)(=O)c2sc(cc12)S(N)(=O)=O |r| |
Structure |
|