Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50377467 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_479700 (CHEMBL933564) |
---|
Ki | 295±n/a nM |
---|
Citation | Gillespie, RJ; Adams, DR; Bebbington, D; Benwell, K; Cliffe, IA; Dawson, CE; Dourish, CT; Fletcher, A; Gaur, S; Giles, PR; Jordan, AM; Knight, AR; Knutsen, LJ; Lawrence, A; Lerpiniere, J; Misra, A; Porter, RH; Pratt, RM; Shepherd, R; Upton, R; Ward, SE; Weiss, SM; Williamson, DS Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett18:2916-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM50377467 |
---|
n/a |
---|
Name | BDBM50377467 |
Synonyms: | CHEMBL408703 |
Type | Small organic molecule |
Emp. Form. | C13H7F3N2O2S |
Mol. Mass. | 312.267 |
SMILES | Cc1ccc(o1)C(=O)c1nc(nc2ccsc12)C(F)(F)F |
Structure |
|