| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50377468 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_479700 (CHEMBL933564) |
|---|
| Ki | 316±n/a nM |
|---|
| Citation |  Gillespie, RJ; Adams, DR; Bebbington, D; Benwell, K; Cliffe, IA; Dawson, CE; Dourish, CT; Fletcher, A; Gaur, S; Giles, PR; Jordan, AM; Knight, AR; Knutsen, LJ; Lawrence, A; Lerpiniere, J; Misra, A; Porter, RH; Pratt, RM; Shepherd, R; Upton, R; Ward, SE; Weiss, SM; Williamson, DS Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett18:2916-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50377468 |
|---|
| n/a |
|---|
| Name | BDBM50377468 |
|---|
| Synonyms: | CHEMBL409547 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H5F3N2O2S |
|---|
| Mol. Mass. | 298.241 |
|---|
| SMILES | FC(F)(F)c1nc(C(=O)c2ccoc2)c2sccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
