Reaction Details |
| Report a problem with these data |
Target | Phospholipase A2, membrane associated |
---|
Ligand | BDBM50250399 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_549472 (CHEMBL997270) |
---|
IC50 | 3900±n/a nM |
---|
Citation | De Rosa, S; Crispino, A; De Giulio, A; Iodice, C; Benrezzouk, R; Terencio, MC; Ferrándiz, ML; Alcaraz, MJ; Payá, M A new cacospongionolide inhibitor of human secretory phospholipase A2 from the Tyrrhenian sponge Fasciospongia cavernosa and absolute configuration of cacospongionolides. J Nat Prod61:931-5 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phospholipase A2, membrane associated |
---|
Name: | Phospholipase A2, membrane associated |
Synonyms: | GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | PA2GA_HUMAN | PLA2B | PLA2G2A | PLA2L | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 group IIA | RASF-A |
Type: | Hydrolase |
Mol. Mass.: | 16101.20 |
Organism: | Homo sapiens (Human) |
Description: | The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification. |
Residue: | 144 |
Sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
|
|
|
BDBM50250399 |
---|
n/a |
---|
Name | BDBM50250399 |
Synonyms: | 5-Hydroxy-4-{(R)-6-hydroxy-5-[(E)-4-methyl-6-(2,6,6-trimethyl-cyclohex-1-enyl)-hex-3-enyl]-3,6-dihydro-2H-pyran-2-yl}-5H-furan-2-one | 5-Hydroxy-4-{6-hydroxy-5-[(E)-4-methyl-6-(2,6,6-trimethyl-cyclohex-1-enyl)-hex-3-enyl]-3,6-dihydro-2H-pyran-2-yl}-5H-furan-2-one | CHEMBL463914 | manoalide |
Type | Small organic molecule |
Emp. Form. | C25H36O5 |
Mol. Mass. | 416.5503 |
SMILES | C\C(CCC1=C(C)CCCC1(C)C)=C/CCC1=CC[C@@H](O[C@H]1O)C1=CC(=O)O[C@H]1O |r,c:4,t:17,25| |
Structure |
|