Reaction Details |
| Report a problem with these data |
Target | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform |
---|
Ligand | BDBM4814 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_531346 (CHEMBL990535) |
---|
Kd | 39±n/a nM |
---|
Citation | McDermott, U; Sharma, SV; Dowell, L; Greninger, P; Montagut, C; Lamb, J; Archibald, H; Raudales, R; Tam, A; Lee, D; Rothenberg, SM; Supko, JG; Sordella, R; Ulkus, LE; Iafrate, AJ; Maheswaran, S; Njauw, CN; Tsao, H; Drew, L; Hanke, JH; Ma, XJ; Erlander, MG; Gray, NS; Haber, DA; Settleman, J Identification of genotype-correlated sensitivity to selective kinase inhibitors by using high-throughput tumor cell line profiling. Proc Natl Acad Sci U S A104:19936-41 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform |
---|
Name: | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform |
Synonyms: | PHKG2 | PHKG2_HUMAN | Phosphorylase kinase | Phosphorylase kinase gamma subunit 2 |
Type: | PROTEIN |
Mol. Mass.: | 46440.15 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_774277 |
Residue: | 406 |
Sequence: | MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
|
|
|
BDBM4814 |
---|
n/a |
---|
Name | BDBM4814 |
Synonyms: | CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US10464902, Sunitinib | US20240058459, Compound Sunit-inib | US9163010, Sunitinib | US9914707, SU11248 |
Type | Small organic molecule |
Emp. Form. | C22H27FN4O2 |
Mol. Mass. | 398.4738 |
SMILES | CCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C |
Structure |
|