| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein kinase FRK |
|---|
| Ligand | BDBM16673 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_531365 (CHEMBL990554) |
|---|
| Kd | 440±n/a nM |
|---|
| Citation |  McDermott, U; Sharma, SV; Dowell, L; Greninger, P; Montagut, C; Lamb, J; Archibald, H; Raudales, R; Tam, A; Lee, D; Rothenberg, SM; Supko, JG; Sordella, R; Ulkus, LE; Iafrate, AJ; Maheswaran, S; Njauw, CN; Tsao, H; Drew, L; Hanke, JH; Ma, XJ; Erlander, MG; Gray, NS; Haber, DA; Settleman, J Identification of genotype-correlated sensitivity to selective kinase inhibitors by using high-throughput tumor cell line profiling. Proc Natl Acad Sci U S A104:19936-41 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein kinase FRK |
|---|
| Name: | Tyrosine-protein kinase FRK |
|---|
| Synonyms: | FRK | FRK_HUMAN | FYN-related kinase | Nuclear tyrosine protein kinase RAK | PTK5 | RAK | SRC | Tyrosine Kinase FRK |
|---|
| Type: | Tyrosine-protein kinase |
|---|
| Mol. Mass.: | 58254.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P42685 |
|---|
| Residue: | 505 |
|---|
| Sequence: | MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAED
LSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGA
IGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR
RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNV
LVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTF
ETLRWKLEDYFETDSSYSDANNFIR
|
|
|
|---|
| BDBM16673 |
|---|
| n/a |
|---|
| Name | BDBM16673 |
|---|
| Synonyms: | 4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide | 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid | BAY 43-9006 | BAY 439006 | BAY439006 | CHEMBL1336 | Hit compound, 8 | Nexavar | Sorafenib | Sorafenib, 4 | US10183928, Sorafenib | US10202365, Compound Sorafenib | US10227329, Compound Sorafenib | US10584114, Compound Sorafenib | US10774070, Compound Sorafenib | US10980809, Example Sorafenib | US11279688, Compound Sorafenib | US11505527, Compound Sorafenib | US9029401, Sorafenib | US9469639, Sorafenib | US9902709, Comparative example 1 | Xarelto | cid_216239 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H16ClF3N4O3 |
|---|
| Mol. Mass. | 464.825 |
|---|
| SMILES | CNC(=O)c1cc(Oc2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2)ccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
