| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 2-associated protein 2 |
|---|
| Ligand | BDBM50242737 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_531384 (CHEMBL966739) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  McDermott, U; Sharma, SV; Dowell, L; Greninger, P; Montagut, C; Lamb, J; Archibald, H; Raudales, R; Tam, A; Lee, D; Rothenberg, SM; Supko, JG; Sordella, R; Ulkus, LE; Iafrate, AJ; Maheswaran, S; Njauw, CN; Tsao, H; Drew, L; Hanke, JH; Ma, XJ; Erlander, MG; Gray, NS; Haber, DA; Settleman, J Identification of genotype-correlated sensitivity to selective kinase inhibitors by using high-throughput tumor cell line profiling. Proc Natl Acad Sci U S A104:19936-41 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 2-associated protein 2 |
|---|
| Name: | Cyclin-dependent kinase 2-associated protein 2 |
|---|
| Synonyms: | CDK2AP2 | CDKA2_HUMAN | DOC1R |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13105.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_531384 |
|---|
| Residue: | 126 |
|---|
| Sequence: | MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQ
AMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAET
ERNART
|
|
|
|---|
| BDBM50242737 |
|---|
| n/a |
|---|
| Name | BDBM50242737 |
|---|
| Synonyms: | (R,Z)-5-(2,6-dichlorobenzylsulfonyl)-3-((3,5-dimethyl-4-(2-(pyrrolidin-1-ylmethyl)pyrrolidine-1-carbonyl)-1H-pyrrol-2-yl)methylene)indolin-2-one | CHEMBL450786 | PHA-665752 | TCMDC-125885 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H34Cl2N4O4S |
|---|
| Mol. Mass. | 641.608 |
|---|
| SMILES | Cc1[nH]c(\C=C2/C(=O)Nc3ccc(cc23)S(=O)(=O)Cc2c(Cl)cccc2Cl)c(C)c1C(=O)N1CCC[C@@H]1CN1CCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
