| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50045877 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_556775 (CHEMBL961473) |
|---|
| Kd | 4±n/a nM |
|---|
| Citation |  Yu, W; Wang, E; Voll, RJ; Miller, AH; Goodman, MM Synthesis, fluorine-18 radiolabeling, and in vitro characterization of 1-iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivatives as potential PET radioligands for imaging peripheral benzodiazepine receptor. Bioorg Med Chem16:6145-55 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50045877 |
|---|
| n/a |
|---|
| Name | BDBM50045877 |
|---|
| Synonyms: | 2-(2-(4-fluorophenyl)-1H-indol-3-yl)-N,N-dihexylacetamide | 2-[2-(4-Fluoro-phenyl)-1H-indol-3-yl]-N,N-dihexyl-acetamide | CHEMBL63154 | [N,N-di-n-hexyl-2-(4-fluorophenyl) indole-3-acetamide] |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H37FN2O |
|---|
| Mol. Mass. | 436.6046 |
|---|
| SMILES | CCCCCCN(CCCCCC)C(=O)Cc1c([nH]c2ccccc12)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
